PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400002483
Common NameLOC102602089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28354.9 Da    PI: 9.9528
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400002483genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34.1e-28959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krienk+ rqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gkl+ yss
  PGSC0003DMP400002483  9 KRIENKISRQVTFSKRRSGLLKKANEISVLCDADVALIVFSTKGKLFQYSS 59
                          79***********************************************96 PP

2K-box103.52.8e-34761751100
                 K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                           y++++ +++++   e+++ e+ kL ++ie Lqr++Rh++G+dL++Lsl+eLq++eqq+++slk+iRs+Kn+l++e+i+elqkke++lqe
  PGSC0003DMP400002483  76 YAETQMNANDSDPKENWSVEYPKLMSRIELLQRNIRHYMGQDLDPLSLRELQSIEQQIDTSLKRIRSRKNQLMHESISELQKKERALQE 164
                           56677777888889*************************************************************************** PP

                 K-box  90 enkaLrkklee 100
                           +n+ ++kkl+e
  PGSC0003DMP400002483 165 QNNLITKKLKE 175
                           ********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.567161IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-38160IPR002100Transcription factor, MADS-box
CDDcd002655.81E-40277No hitNo description
SuperFamilySSF554551.57E-32291IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-293859IPR002100Transcription factor, MADS-box
PfamPF014864.0E-2985173IPR002487Transcription factor, K-box
PROSITE profilePS5129716.71489179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGRVELKR IENKISRQVT FSKRRSGLLK KANEISVLCD ADVALIVFST KGKLFQYSST  60
DSSMESILER YERYSYAETQ MNANDSDPKE NWSVEYPKLM SRIELLQRNI RHYMGQDLDP  120
LSLRELQSIE QQIDTSLKRI RSRKNQLMHE SISELQKKER ALQEQNNLIT KKLKENEKTQ  180
PNSSTFHVPP SHSHHLPNLT IGGAFGGMNR DGSGQVHQYP GSNNNNNNNS NSSLIPPWML  240
RHVSNEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-21175173Myocyte-specific enhancer factor 2B
1tqe_Q2e-21175173Myocyte-specific enhancer factor 2B
1tqe_R2e-21175173Myocyte-specific enhancer factor 2B
1tqe_S2e-21175173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0131260.0BT013126.1 Lycopersicon esculentum clone 114416F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338337.10.0PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ424291e-92AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLM0ZLS20.0M0ZLS2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000034850.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.18e-89MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]